Lineage for d1ubga2 (1ubg A:271-330)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328282Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 328283Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) (S)
  5. 328284Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 328285Protein RecA protein, C-terminal domain [54754] (3 species)
  7. 328290Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries)
  8. 328293Domain d1ubga2: 1ubg A:271-330 [88417]
    Other proteins in same PDB: d1ubga1
    complexed with dtp

Details for d1ubga2

PDB Entry: 1ubg (more details), 3.5 Å

PDB Description: MsREcA-dATP complex

SCOP Domain Sequences for d1ubga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubga2 d.48.1.1 (A:271-330) RecA protein, C-terminal domain {Mycobacterium smegmatis}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg

SCOP Domain Coordinates for d1ubga2:

Click to download the PDB-style file with coordinates for d1ubga2.
(The format of our PDB-style files is described here.)

Timeline for d1ubga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ubga1