Lineage for d1ubga2 (1ubg A:271-330)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
alpha-beta(3)-alpha(2); 2 layers, alpha/betaSuperfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) 
Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein) Protein RecA protein, C-terminal domain [54754] (5 species) 
Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries) 
Domain d1ubga2: 1ubg A:271-330 [88417]
Other proteins in same PDB: d1ubga1
protein/DNA complex; complexed with dtp
Details for d1ubga2
PDB Entry: 1ubg (more details), 3.5 Å
PDB Description: MsREcA-dATP complex
PDB Compounds: (A:) RecASCOPe Domain Sequences for d1ubga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubga2 d.48.1.1 (A:271-330) RecA protein, C-terminal domain {Mycobacterium smegmatis [TaxId: 1772]}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
SCOPe Domain Coordinates for d1ubga2:
Click to download the PDB-style file with coordinates for d1ubga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ubga2:
- d1ubga2 first appeared in SCOP 1.65
- d1ubga2 appears in SCOPe 2.07
View in 3D
