![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
![]() | Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) ![]() |
![]() | Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein) |
![]() | Protein RecA protein, C-terminal domain [54754] (5 species) |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries) |
![]() | Domain d1ubga2: 1ubg A:271-330 [88417] Other proteins in same PDB: d1ubga1 protein/DNA complex; complexed with dtp |
PDB Entry: 1ubg (more details), 3.5 Å
SCOPe Domain Sequences for d1ubga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubga2 d.48.1.1 (A:271-330) RecA protein, C-terminal domain {Mycobacterium smegmatis [TaxId: 1772]} sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
Timeline for d1ubga2: