Lineage for d1ubga1 (1ubg A:1-270)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394452Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (12 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 394656Protein RecA protein, ATPase-domain [52671] (3 species)
    C-terminal domain is alpha+beta
  7. 394660Species Mycobacterium smegmatis [TaxId:1772] [89675] (4 PDB entries)
  8. 394663Domain d1ubga1: 1ubg A:1-270 [88416]
    Other proteins in same PDB: d1ubga2
    complexed with dtp

Details for d1ubga1

PDB Entry: 1ubg (more details), 3.5 Å

PDB Description: MsREcA-dATP complex

SCOP Domain Sequences for d1ubga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubga1 c.37.1.11 (A:1-270) RecA protein, ATPase-domain {Mycobacterium smegmatis}
maqqapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglpr
grvieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsq
pdtgeqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkm
tgalnnsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdav
gnrtrvkvvknkvsppfkqaefdilygqgi

SCOP Domain Coordinates for d1ubga1:

Click to download the PDB-style file with coordinates for d1ubga1.
(The format of our PDB-style files is described here.)

Timeline for d1ubga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ubga2