![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein RecA protein, ATPase-domain [52671] (6 species) C-terminal domain is alpha+beta |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [89675] (4 PDB entries) |
![]() | Domain d1ubga1: 1ubg A:1-270 [88416] Other proteins in same PDB: d1ubga2 protein/DNA complex; complexed with dtp |
PDB Entry: 1ubg (more details), 3.5 Å
SCOPe Domain Sequences for d1ubga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubga1 c.37.1.11 (A:1-270) RecA protein, ATPase-domain {Mycobacterium smegmatis [TaxId: 1772]} maqqapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglpr grvieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsq pdtgeqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkm tgalnnsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdav gnrtrvkvvknkvsppfkqaefdilygqgi
Timeline for d1ubga1: