| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) ![]() |
| Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein) |
| Protein RecA protein, C-terminal domain [54754] (5 species) |
| Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries) |
| Domain d1ubfa2: 1ubf A:271-331 [88415] Other proteins in same PDB: d1ubfa1 protein/DNA complex; complexed with ags |
PDB Entry: 1ubf (more details), 3.5 Å
SCOPe Domain Sequences for d1ubfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubfa2 d.48.1.1 (A:271-331) RecA protein, C-terminal domain {Mycobacterium smegmatis [TaxId: 1772]}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
i
Timeline for d1ubfa2: