SCOPe 2.06: Domain d1ubfa2: 1ubf A:271-331

Lineage for d1ubfa2 (1ubf A:271-331)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
   alpha-beta(3)-alpha(2); 2 layers, alpha/beta

4. Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families)

5. Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)

6. Protein RecA protein, C-terminal domain [54754] (5 species)

7. Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries)

8. Domain d1ubfa2: 1ubf A:271-331 [88415]
   Other proteins in same PDB: d1ubfa1
   protein/DNA complex; complexed with ags

Details for d1ubfa2

PDB Entry: 1ubf, 3.5 Å

PDB Description: MsREcA-ATPgS complex

PDB Compounds: (A:) RecA

SCOPe Domain Sequences for d1ubfa2:

Sequence; same for both SEQRES and ATOM records:

>d1ubfa2 d.48.1.1 (A:271-331) RecA protein, C-terminal domain {Mycobacterium smegmatis [TaxId: 1772]}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
i

Timeline for d1ubfa2:

• d1ubfa2 first appeared in SCOP 1.65
  
• d1ubfa2 appears in SCOPe 2.05
  
• d1ubfa2 appears in SCOPe 2.07
  
• d1ubfa2 appears in the current release, SCOPe 2.08