Lineage for d1ubfa2 (1ubf A:271-331)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411303Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 411304Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) (S)
  5. 411305Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 411306Protein RecA protein, C-terminal domain [54754] (3 species)
  7. 411311Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries)
  8. 411313Domain d1ubfa2: 1ubf A:271-331 [88415]
    Other proteins in same PDB: d1ubfa1
    complexed with sap

Details for d1ubfa2

PDB Entry: 1ubf (more details), 3.5 Å

PDB Description: MsREcA-ATPgS complex

SCOP Domain Sequences for d1ubfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubfa2 d.48.1.1 (A:271-331) RecA protein, C-terminal domain {Mycobacterium smegmatis}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
i

SCOP Domain Coordinates for d1ubfa2:

Click to download the PDB-style file with coordinates for d1ubfa2.
(The format of our PDB-style files is described here.)

Timeline for d1ubfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ubfa1