Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) |
Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein) |
Protein RecA protein, C-terminal domain [54754] (3 species) |
Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries) |
Domain d1ubfa2: 1ubf A:271-331 [88415] Other proteins in same PDB: d1ubfa1 complexed with sap |
PDB Entry: 1ubf (more details), 3.5 Å
SCOP Domain Sequences for d1ubfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubfa2 d.48.1.1 (A:271-331) RecA protein, C-terminal domain {Mycobacterium smegmatis} sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg i
Timeline for d1ubfa2: