Lineage for d1ubfa2 (1ubf A:271-331)
- Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds) 
Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
alpha-beta(3)-alpha(2); 2 layers, alpha/betaSuperfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) 
Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein) Protein RecA protein, C-terminal domain [54754] (3 species) 
Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries) 
Domain d1ubfa2: 1ubf A:271-331 [88415]
Other proteins in same PDB: d1ubfa1
complexed with sap
Details for d1ubfa2
PDB Entry: 1ubf (more details), 3.5 Å
PDB Description: MsREcA-ATPgS complex
SCOP Domain Sequences for d1ubfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubfa2 d.48.1.1 (A:271-331) RecA protein, C-terminal domain {Mycobacterium smegmatis}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
i
SCOP Domain Coordinates for d1ubfa2:
Click to download the PDB-style file with coordinates for d1ubfa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ubfa2:
- d1ubfa2 is new in SCOP 1.65
- d1ubfa2 appears in SCOP 1.67
- d1ubfa2 appears in the current release, SCOPe 2.08
View in 3D
