Lineage for d1ubfa1 (1ubf A:4-270)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112601Protein RecA protein, ATPase-domain [52671] (6 species)
    C-terminal domain is alpha+beta
  7. 2112614Species Mycobacterium smegmatis [TaxId:1772] [89675] (4 PDB entries)
  8. 2112616Domain d1ubfa1: 1ubf A:4-270 [88414]
    Other proteins in same PDB: d1ubfa2
    protein/DNA complex; complexed with ags

Details for d1ubfa1

PDB Entry: 1ubf (more details), 3.5 Å

PDB Description: MsREcA-ATPgS complex
PDB Compounds: (A:) RecA

SCOPe Domain Sequences for d1ubfa1:

Sequence, based on SEQRES records: (download)

>d1ubfa1 c.37.1.11 (A:4-270) RecA protein, ATPase-domain {Mycobacterium smegmatis [TaxId: 1772]}
qapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrv
ieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdt
geqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkmtga
lnnsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdavgnr
trvkvvknkvsppfkqaefdilygqgi

Sequence, based on observed residues (ATOM records): (download)

>d1ubfa1 c.37.1.11 (A:4-270) RecA protein, ATPase-domain {Mycobacterium smegmatis [TaxId: 1772]}
qapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrv
ieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdt
geqaleiadmlvrsgaldiividsvaalvpraeiegglqarlmsqalrkmtgalnnsgtt
aifinqlrekitggkalkfyasvrldvrrietlkdgtdavgnrtrvkvvknkvsppfkqa
efdilygqgi

SCOPe Domain Coordinates for d1ubfa1:

Click to download the PDB-style file with coordinates for d1ubfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ubfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ubfa2