Lineage for d1ubea2 (1ube A:271-330)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503256Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 503257Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) (S)
  5. 503258Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 503259Protein RecA protein, C-terminal domain [54754] (3 species)
  7. 503267Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries)
  8. 503268Domain d1ubea2: 1ube A:271-330 [88413]
    Other proteins in same PDB: d1ubea1

Details for d1ubea2

PDB Entry: 1ube (more details), 3.3 Å

PDB Description: MsRecA-ADP Complex

SCOP Domain Sequences for d1ubea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubea2 d.48.1.1 (A:271-330) RecA protein, C-terminal domain {Mycobacterium smegmatis}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg

SCOP Domain Coordinates for d1ubea2:

Click to download the PDB-style file with coordinates for d1ubea2.
(The format of our PDB-style files is described here.)

Timeline for d1ubea2:

503268
d1ubea2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ubea1