![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
![]() | Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) ![]() |
![]() | Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein) |
![]() | Protein RecA protein, C-terminal domain [54754] (3 species) |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [89911] (4 PDB entries) |
![]() | Domain d1ubca2: 1ubc A:271-330 [88411] Other proteins in same PDB: d1ubca1 |
PDB Entry: 1ubc (more details), 3.8 Å
SCOP Domain Sequences for d1ubca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubca2 d.48.1.1 (A:271-330) RecA protein, C-terminal domain {Mycobacterium smegmatis} sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
Timeline for d1ubca2: