Lineage for d1ub7d1 (1ub7 D:2-173)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881522Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1881650Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 1881727Species Thermus thermophilus [TaxId:274] [89794] (1 PDB entry)
  8. 1881734Domain d1ub7d1: 1ub7 D:2-173 [88408]
    complexed with gol

Details for d1ub7d1

PDB Entry: 1ub7 (more details), 2.3 Å

PDB Description: The Crystal Analysis of Beta-Keroacyl-[Acyl Carrier Protein] Synthase III (FABH)From Thermus Thermophilus.
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier protein] synthase

SCOPe Domain Sequences for d1ub7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub7d1 c.95.1.2 (D:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]}
sgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkavedl
lrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqah
alveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygf

SCOPe Domain Coordinates for d1ub7d1:

Click to download the PDB-style file with coordinates for d1ub7d1.
(The format of our PDB-style files is described here.)

Timeline for d1ub7d1: