![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
![]() | Protein Ketoacyl-ACP synthase III (FabH) [53912] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [89794] (1 PDB entry) |
![]() | Domain d1ub7c2: 1ub7 C:174-322 [88407] complexed with gol |
PDB Entry: 1ub7 (more details), 2.3 Å
SCOPe Domain Sequences for d1ub7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ub7c2 c.95.1.2 (C:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} rsfvlgadgtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaieka gltpedirlfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdag riregdhvllvsfgagltwaaavltwgga
Timeline for d1ub7c2: