SCOP 1.71: Domain d1ub7b2: 1ub7 B:174-322

Lineage for d1ub7b2 (1ub7 B:174-322)

Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (2 families)
Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
Species Thermus thermophilus [TaxId:274] [89794] (1 PDB entry)
Domain d1ub7b2: 1ub7 B:174-322 [88405]

Details for d1ub7b2

PDB Entry: 1ub7 (more details), 2.3 Å

PDB Description: The Crystal Analysis of Beta-Keroacyl-[Acyl Carrier Protein] Synthase III (FABH)From Thermus Thermophilus.

SCOP Domain Sequences for d1ub7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub7b2 c.95.1.2 (B:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus}
rsfvlgadgtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaieka
gltpedirlfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdag
riregdhvllvsfgagltwaaavltwgga

SCOP Domain Coordinates for d1ub7b2:

Click to download the PDB-style file with coordinates for d1ub7b2.
(The format of our PDB-style files is described here.)

Timeline for d1ub7b2: