Lineage for d1ub7a2 (1ub7 A:174-322)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest
  4. 322247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 322248Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 322406Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 322435Species Thermus thermophilus [TaxId:274] [89794] (1 PDB entry)
  8. 322437Domain d1ub7a2: 1ub7 A:174-322 [88403]

Details for d1ub7a2

PDB Entry: 1ub7 (more details), 2.3 Å

PDB Description: The Crystal Analysis of Beta-Keroacyl-[Acyl Carrier Protein] Synthase III (FABH)From Thermus Thermophilus.

SCOP Domain Sequences for d1ub7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub7a2 c.95.1.1 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus}
rsfvlgadgtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaieka
gltpedirlfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdag
riregdhvllvsfgagltwaaavltwgga

SCOP Domain Coordinates for d1ub7a2:

Click to download the PDB-style file with coordinates for d1ub7a2.
(The format of our PDB-style files is described here.)

Timeline for d1ub7a2: