Lineage for d1ub4b_ (1ub4 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2378268Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2378305Family b.34.6.2: Kid/PemK [82075] (4 protein domains)
    automatically mapped to Pfam PF02452
  6. 2378312Protein MazF protein [89303] (1 species)
  7. 2378313Species Escherichia coli [TaxId:562] [89304] (2 PDB entries)
  8. 2378315Domain d1ub4b_: 1ub4 B: [88400]
    Other proteins in same PDB: d1ub4c_
    complexed with the antidote protein MazE
    protein/DNA complex

Details for d1ub4b_

PDB Entry: 1ub4 (more details), 1.7 Å

PDB Description: crystal structure of MazEF complex
PDB Compounds: (B:) MazF protein

SCOPe Domain Sequences for d1ub4b_:

Sequence, based on SEQRES records: (download)

>d1ub4b_ b.34.6.2 (B:) MazF protein {Escherichia coli [TaxId: 562]}
vsryvpdmgdliwvdfdptkgseqaghrpavvlspfmynnktgmclcvpcttqskgypfe
vvlsgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig

Sequence, based on observed residues (ATOM records): (download)

>d1ub4b_ b.34.6.2 (B:) MazF protein {Escherichia coli [TaxId: 562]}
vsryvpdmgdliwvdfhrpavvlspfmynnktgmclcvpcttqskgypfevvlsgqerdg
valadqvksiawrargatkkgtvapeelqlikakinvlig

SCOPe Domain Coordinates for d1ub4b_:

Click to download the PDB-style file with coordinates for d1ub4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ub4b_: