SCOP 1.73: Domain d1ub3b_: 1ub3 B:

Lineage for d1ub3b_ (1ub3 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)

7. Species Thermus thermophilus [TaxId:274] [89492] (2 PDB entries)

8. Domain d1ub3b_: 1ub3 B: [88396]

Details for d1ub3b_

PDB Entry: 1ub3, 1.4 Å

PDB Description: Crystal Structure of Tetrameric Structure of Aldolase from thermus thermophilus HB8

PDB Compounds: (B:) Aldolase protein

SCOP Domain Sequences for d1ub3b_:

Sequence; same for both SEQRES and ATOM records:

>d1ub3b_ c.1.10.1 (B:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]}
mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
aaggirdretalrmlkagasrlgtssgvalv

Timeline for d1ub3b_:

• d1ub3b_ first appeared in SCOP 1.65
  
• d1ub3b_ appears in SCOP 1.71
  
• d1ub3b_ appears in SCOP 1.75
  
• d1ub3b_ appears in the current release, SCOPe 2.08