Lineage for d1ub0a_ (1ub0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137573Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 protein domains)
  6. 2137574Protein 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) [69589] (2 species)
  7. 2137580Species Thermus thermophilus [TaxId:274] [89775] (1 PDB entry)
  8. 2137581Domain d1ub0a_: 1ub0 A: [88394]
    structural genomics
    complexed with dio, gol, so4

Details for d1ub0a_

PDB Entry: 1ub0 (more details), 2.05 Å

PDB Description: Crystal Structure Analysis of Phosphomethylpyrimidine Kinase (ThiD) from Thermus Thermophilus Hb8
PDB Compounds: (A:) phosphomethylpyrimidine kinase

SCOPe Domain Sequences for d1ub0a_:

Sequence, based on SEQRES records: (download)

>d1ub0a_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Thermus thermophilus [TaxId: 274]}
mrvaltiagsdsgggagvqadlkvffrfgvygtsaltlvtaqntlgvqrvhllppevvya
qiesvaqdfplhaaktgalgdaaiveavaeavrrfgvrplvvdpvmvaksgdpllakeaa
aalkerlfpladlvtpnrleaeallgrpirtlkeaeeaakallalgpkavllkgghlege
eavdllatrggvlrfsaprvhtrnthgtgctlsaaiaallakgrplaeavaeakayltra
lktapslghghgpldhwa

Sequence, based on observed residues (ATOM records): (download)

>d1ub0a_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Thermus thermophilus [TaxId: 274]}
mrvaltiagsdsgggagvqadlkvffrfgvygtsaltlvtaqntlgvqrvhllppevvya
qiesvaqdfplhaaktgalgdaaiveavaeavrrfgvrplvvdpvmakeaaaalkerlfp
ladlvtpnrleaeallgrpirtlkeaeeaakallalgpkavllkgghleavdllatrggv
lrfsaprvhtrnthgtgctlsaaiaallakgrplaeavaeakayltralktapslghghg
pldhwa

SCOPe Domain Coordinates for d1ub0a_:

Click to download the PDB-style file with coordinates for d1ub0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ub0a_: