Lineage for d1uayb_ (1uay B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842839Protein Type II 3-hydroxyacyl-CoA dehydrogenase [63933] (3 species)
  7. 2842859Species Thermus thermophilus [TaxId:274] [89525] (1 PDB entry)
  8. 2842861Domain d1uayb_: 1uay B: [88391]
    complexed with adn

Details for d1uayb_

PDB Entry: 1uay (more details), 1.4 Å

PDB Description: Crystal Structure of Type II 3-Hydroxyacyl-CoA Dehydrogenase from Thermus thermophilus HB8
PDB Compounds: (B:) Type II 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d1uayb_:

Sequence, based on SEQRES records: (download)

>d1uayb_ c.2.1.2 (B:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
mersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravar
aqeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenp
pdaegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapgl
fdtpllqglpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrma
pr

Sequence, based on observed residues (ATOM records): (download)

>d1uayb_ c.2.1.2 (B:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
mersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravar
aqeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenp
pdaegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapgl
fdtplpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrmapr

SCOPe Domain Coordinates for d1uayb_:

Click to download the PDB-style file with coordinates for d1uayb_.
(The format of our PDB-style files is described here.)

Timeline for d1uayb_: