Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Melibiase [75020] (4 species) |
Species Rice (Oryza sativa) [TaxId:4530] [89387] (1 PDB entry) alpha-galactosidase |
Domain d1uasa1: 1uas A:274-362 [88388] Other proteins in same PDB: d1uasa2 complexed with gla, gol, pt, so4 |
PDB Entry: 1uas (more details), 1.5 Å
SCOPe Domain Sequences for d1uasa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uasa1 b.71.1.1 (A:274-362) Melibiase {Rice (Oryza sativa) [TaxId: 4530]} lgvqgkkvqsdnglevwagplsnnrkavvlwnrqsyqatitahwsniglagsvavtardl wahssfaaqgqisasvaphdckmyvltpn
Timeline for d1uasa1: