Lineage for d1uasa1 (1uas A:274-362)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804047Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1804371Protein Melibiase [75020] (4 species)
  7. 1804410Species Rice (Oryza sativa) [TaxId:4530] [89387] (1 PDB entry)
    alpha-galactosidase
  8. 1804411Domain d1uasa1: 1uas A:274-362 [88388]
    Other proteins in same PDB: d1uasa2
    complexed with gla, gol, pt, so4

Details for d1uasa1

PDB Entry: 1uas (more details), 1.5 Å

PDB Description: crystal structure of rice alpha-galactosidase
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d1uasa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uasa1 b.71.1.1 (A:274-362) Melibiase {Rice (Oryza sativa) [TaxId: 4530]}
lgvqgkkvqsdnglevwagplsnnrkavvlwnrqsyqatitahwsniglagsvavtardl
wahssfaaqgqisasvaphdckmyvltpn

SCOPe Domain Coordinates for d1uasa1:

Click to download the PDB-style file with coordinates for d1uasa1.
(The format of our PDB-style files is described here.)

Timeline for d1uasa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uasa2