Lineage for d1uaqb_ (1uaq B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594389Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 594390Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 594422Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (3 proteins)
    strand 5 is parallel to strand 4
  6. 594423Protein Cytosine deaminase [89801] (1 species)
  7. 594424Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (4 PDB entries)
  8. 594430Domain d1uaqb_: 1uaq B: [88387]
    complexed with duc, zn

Details for d1uaqb_

PDB Entry: 1uaq (more details), 1.6 Å

PDB Description: The crystal structure of yeast cytosine deaminase

SCOP Domain Sequences for d1uaqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uaqb_ c.97.1.2 (B:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae)}
skwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeist
lencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrgh
evvvvdderckkimkqfiderpqdwfedige

SCOP Domain Coordinates for d1uaqb_:

Click to download the PDB-style file with coordinates for d1uaqb_.
(The format of our PDB-style files is described here.)

Timeline for d1uaqb_: