SCOP 1.67: Domain d1uaqb_: 1uaq B:

Lineage for d1uaqb_ (1uaq B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families)

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (1 protein)

6. Protein Cytosine deaminase [89801] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (4 PDB entries)

8. Domain d1uaqb_: 1uaq B: [88387]
   complexed with duc, zn

Details for d1uaqb_

PDB Entry: 1uaq, 1.6 Å

PDB Description: The crystal structure of yeast cytosine deaminase

SCOP Domain Sequences for d1uaqb_:

Sequence; same for both SEQRES and ATOM records:

>d1uaqb_ c.97.1.2 (B:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae)}
skwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeist
lencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrgh
evvvvdderckkimkqfiderpqdwfedige

Timeline for d1uaqb_:

• d1uaqb_ first appeared in SCOP 1.65
  
• d1uaqb_ appears in SCOP 1.69
  
• d1uaqb_ appears in the current release, SCOPe 2.08