SCOP 1.65: Domain d1uaqa_: 1uaq A:

Lineage for d1uaqa_ (1uaq A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families)

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (1 protein)

6. Protein Cytosine deaminase [89801] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (1 PDB entry)

8. Domain d1uaqa_: 1uaq A: [88386]

Details for d1uaqa_

PDB Entry: 1uaq, 1.6 Å

PDB Description: The crystal structure of yeast cytosine deaminase

SCOP Domain Sequences for d1uaqa_:

Sequence; same for both SEQRES and ATOM records:

>d1uaqa_ c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae)}
skwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeist
lencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrgh
evvvvdderckkimkqfiderpqdwfedige

Timeline for d1uaqa_:

• d1uaqa_ is new in SCOP 1.65
  
• d1uaqa_ appears in SCOP 1.67
  
• d1uaqa_ appears in the current release, SCOPe 2.08