Lineage for d1uapa1 (1uap A:25-154)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382696Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2382729Family b.40.3.3: Netrin-like domain (NTR/C345C module) [89320] (3 protein domains)
    Pfam PF01759
  6. 2382737Protein Procollagen c-proteinase enhancer protein PCOLCE [89321] (1 species)
  7. 2382738Species Human (Homo sapiens) [TaxId:9606] [89322] (1 PDB entry)
  8. 2382739Domain d1uapa1: 1uap A:25-154 [88385]
    Other proteins in same PDB: d1uapa2

Details for d1uapa1

PDB Entry: 1uap (more details)

PDB Description: NMR structure of the NTR domain from human PCOLCE1
PDB Compounds: (A:) Procollagen C-proteinase enhancer protein

SCOPe Domain Sequences for d1uapa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uapa1 b.40.3.3 (A:25-154) Procollagen c-proteinase enhancer protein PCOLCE {Human (Homo sapiens) [TaxId: 9606]}
pdaptcpkqcrrtgtlqsnfcasslvvtatvksmvrepgeglavtvsligayktggldlp
spptgaslkfyvpckqcppmkkgvsyllmgqveenrgpvlppesfvvlhrpnqdqiltnl
skrkcpsqpv

SCOPe Domain Coordinates for d1uapa1:

Click to download the PDB-style file with coordinates for d1uapa1.
(The format of our PDB-style files is described here.)

Timeline for d1uapa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uapa2