Lineage for d1uaja1 (1uaj A:1-246)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150174Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2150175Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2150238Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 protein domains)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 2150239Protein tRNA(m1G37)-methyltransferase TrmD [89630] (3 species)
  7. 2150246Species Haemophilus influenzae [TaxId:727] [89631] (4 PDB entries)
  8. 2150248Domain d1uaja1: 1uaj A:1-246 [88381]
    Other proteins in same PDB: d1uaja2

Details for d1uaja1

PDB Entry: 1uaj (more details), 1.85 Å

PDB Description: Crystal structure of tRNA(m1G37)methyltransferase: Insight into tRNA recognition
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d1uaja1:

Sequence, based on SEQRES records: (download)

>d1uaja1 c.116.1.4 (A:1-246) tRNA(m1G37)-methyltransferase TrmD {Haemophilus influenzae [TaxId: 727]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea
qaehns

Sequence, based on observed residues (ATOM records): (download)

>d1uaja1 c.116.1.4 (A:1-246) tRNA(m1G37)-methyltransferase TrmD {Haemophilus influenzae [TaxId: 727]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlglldcphytrpevlegltvp
pvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehns

SCOPe Domain Coordinates for d1uaja1:

Click to download the PDB-style file with coordinates for d1uaja1.
(The format of our PDB-style files is described here.)

Timeline for d1uaja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uaja2