Lineage for d1uadd_ (1uad D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770987Family b.1.18.18: Other IPT/TIG domains [89191] (1 protein)
    apart from the domains of transcription factors and sugar-utilizing enzymes
    automatically mapped to Pfam PF01833
  6. 1770988Protein Exocyst complex component Sec5, Ral-binding domain [89192] (1 species)
  7. 1770989Species Mouse (Mus musculus) [TaxId:10090] [89193] (2 PDB entries)
  8. 1770991Domain d1uadd_: 1uad D: [88380]
    Other proteins in same PDB: d1uada_, d1uadb_
    complex with RalA
    complexed with gnp, mg

Details for d1uadd_

PDB Entry: 1uad (more details), 2.1 Å

PDB Description: Crystal structure of the RalA-GppNHp-Sec5 Ral-binding domain complex
PDB Compounds: (D:) exocyst complex component sec5

SCOPe Domain Sequences for d1uadd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uadd_ b.1.18.18 (D:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
srqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivcr
vgqakndkgdiivttksggrgtstvsfkllkp

SCOPe Domain Coordinates for d1uadd_:

Click to download the PDB-style file with coordinates for d1uadd_.
(The format of our PDB-style files is described here.)

Timeline for d1uadd_: