![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.18: Other IPT/TIG domains [89191] (1 protein) apart from the domains of transcription factors and sugar-utilizing enzymes |
![]() | Protein Exocyst complex component Sec5, Ral-binding domain [89192] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [89193] (2 PDB entries) |
![]() | Domain d1uadd_: 1uad D: [88380] Other proteins in same PDB: d1uada_, d1uadb_ complex with RalA complexed with gnp, mg |
PDB Entry: 1uad (more details), 2.1 Å
SCOP Domain Sequences for d1uadd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uadd_ b.1.18.18 (D:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]} srqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivcr vgqakndkgdiivttksggrgtstvsfkllkp
Timeline for d1uadd_: