Lineage for d1uadd_ (1uad D:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291884Family b.1.18.18: Other IPT/TIG domains [89191] (1 protein)
    apart from the domains of transcription factors and sugar-utilizing enzymes
  6. 291885Protein Exocyst complex component Sec5, Ral-binding domain [89192] (1 species)
  7. 291886Species Mouse (Mus musculus) [TaxId:10090] [89193] (2 PDB entries)
  8. 291888Domain d1uadd_: 1uad D: [88380]
    Other proteins in same PDB: d1uada_, d1uadb_
    complex with RalA
    complexed with gnp, mg

Details for d1uadd_

PDB Entry: 1uad (more details), 2.1 Å

PDB Description: Crystal structure of the RalA-GppNHp-Sec5 Ral-binding domain complex

SCOP Domain Sequences for d1uadd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uadd_ b.1.18.18 (D:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus)}
srqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivcr
vgqakndkgdiivttksggrgtstvsfkllkp

SCOP Domain Coordinates for d1uadd_:

Click to download the PDB-style file with coordinates for d1uadd_.
(The format of our PDB-style files is described here.)

Timeline for d1uadd_: