SCOPe 2.05: Domain d1uadc_: 1uad C:

Lineage for d1uadc_ (1uad C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.18: Other IPT/TIG domains [89191] (1 protein)
   apart from the domains of transcription factors and sugar-utilizing enzymes
   automatically mapped to Pfam PF01833

6. Protein Exocyst complex component Sec5, Ral-binding domain [89192] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89193] (2 PDB entries)

8. Domain d1uadc_: 1uad C: [88379]
   Other proteins in same PDB: d1uada_, d1uadb_
   complex with RalA
   complexed with gnp, mg

Details for d1uadc_

PDB Entry: 1uad, 2.1 Å

PDB Description: Crystal structure of the RalA-GppNHp-Sec5 Ral-binding domain complex

PDB Compounds: (C:) exocyst complex component sec5

SCOPe Domain Sequences for d1uadc_:

Sequence; same for both SEQRES and ATOM records:

>d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
srqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivcr
vgqakndkgdiivttksggrgtstvsfkllkp

Timeline for d1uadc_:

• d1uadc_ first appeared in SCOP 1.65
  
• d1uadc_ appears in SCOPe 2.04
  
• d1uadc_ appears in SCOPe 2.06
  
• d1uadc_ appears in the current release, SCOPe 2.08