SCOPe 2.06: Domain d1uadb_: 1uad B:

Lineage for d1uadb_ (1uad B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries)

8. Domain d1uadb_: 1uad B: [88378]
   Other proteins in same PDB: d1uadc_, d1uadd_
   complexed with the Sec5 domain Ral-binding domain
   complexed with gnp, mg

Details for d1uadb_

PDB Entry: 1uad, 2.1 Å

PDB Description: Crystal structure of the RalA-GppNHp-Sec5 Ral-binding domain complex

PDB Compounds: (B:) Ras-related protein Ral-A

SCOPe Domain Sequences for d1uadb_:

Sequence; same for both SEQRES and ATOM records:

>d1uadb_ c.37.1.8 (B:) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds

Timeline for d1uadb_:

• d1uadb_ first appeared in SCOP 1.65
  
• d1uadb_ appears in SCOPe 2.05
  
• d1uadb_ appears in SCOPe 2.07
  
• d1uadb_ appears in the current release, SCOPe 2.08