Lineage for d1uadb_ (1uad B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484511Protein Ras-related protein RalA [89662] (1 species)
  7. 484512Species Human (Homo sapiens) [TaxId:9606] [89663] (1 PDB entry)
  8. 484514Domain d1uadb_: 1uad B: [88378]
    Other proteins in same PDB: d1uadc_, d1uadd_
    complexed with the Sec5 domain Ral-binding domain

Details for d1uadb_

PDB Entry: 1uad (more details), 2.1 Å

PDB Description: Crystal structure of the RalA-GppNHp-Sec5 Ral-binding domain complex

SCOP Domain Sequences for d1uadb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uadb_ c.37.1.8 (B:) Ras-related protein RalA {Human (Homo sapiens)}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds

SCOP Domain Coordinates for d1uadb_:

Click to download the PDB-style file with coordinates for d1uadb_.
(The format of our PDB-style files is described here.)

Timeline for d1uadb_: