| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (35 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Ras-related protein RalA [89662] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89663] (1 PDB entry) |
| Domain d1uadb_: 1uad B: [88378] Other proteins in same PDB: d1uadc_, d1uadd_ complexed with the Sec5 domain Ral-binding domain complexed with gnp, mg |
PDB Entry: 1uad (more details), 2.1 Å
SCOP Domain Sequences for d1uadb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uadb_ c.37.1.8 (B:) Ras-related protein RalA {Human (Homo sapiens)}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
Timeline for d1uadb_: