SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1uadb_ (1uad B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110940Protein Ras-related protein RalA [89662] (2 species)
  7. 2110948Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries)
  8. 2110954Domain d1uadb_: 1uad B: [88378]
    Other proteins in same PDB: d1uadc_, d1uadd_
    complexed with the Sec5 domain Ral-binding domain
    complexed with gnp, mg

Details for d1uadb_

PDB Entry: 1uad (more details), 2.1 Å

PDB Description: Crystal structure of the RalA-GppNHp-Sec5 Ral-binding domain complex
PDB Compounds: (B:) Ras-related protein Ral-A

SCOPe Domain Sequences for d1uadb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uadb_ c.37.1.8 (B:) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds

SCOPe Domain Coordinates for d1uadb_:

Click to download the PDB-style file with coordinates for d1uadb_.
(The format of our PDB-style files is described here.)

Timeline for d1uadb_: