Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ras-related protein RalA [89662] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries) |
Domain d1uada_: 1uad A: [88377] Other proteins in same PDB: d1uadc_, d1uadd_ complexed with the Sec5 domain Ral-binding domain complexed with gnp, mg |
PDB Entry: 1uad (more details), 2.1 Å
SCOPe Domain Sequences for d1uada_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uada_ c.37.1.8 (A:) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]} slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
Timeline for d1uada_: