Lineage for d1ua8a_ (1ua8 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077315Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2077316Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2077317Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 protein domains)
    automatically mapped to Pfam PF03548
  6. 2077318Protein Outer-membrane lipoproteins carrier protein LolA [89394] (1 species)
  7. 2077319Species Escherichia coli [TaxId:562] [89395] (3 PDB entries)
  8. 2077322Domain d1ua8a_: 1ua8 A: [88376]

Details for d1ua8a_

PDB Entry: 1ua8 (more details), 1.9 Å

PDB Description: Crystal structure of the lipoprotein localization factor, LolA
PDB Compounds: (A:) Outer-membrane lipoproteins carrier protein

SCOPe Domain Sequences for d1ua8a_:

Sequence, based on SEQRES records: (download)

>d1ua8a_ b.125.1.1 (A:) Outer-membrane lipoproteins carrier protein LolA {Escherichia coli [TaxId: 562]}
daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlfnwhmtqpdesilv
sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas
ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq
rk

Sequence, based on observed residues (ATOM records): (download)

>d1ua8a_ b.125.1.1 (A:) Outer-membrane lipoproteins carrier protein LolA {Escherichia coli [TaxId: 562]}
daasdlksrldkvssfhasftqkvtdgqegqgdlwvkrpnlfnwhmtqpdesilvsdgkt
lwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkanlkqft
invgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddqrk

SCOPe Domain Coordinates for d1ua8a_:

Click to download the PDB-style file with coordinates for d1ua8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ua8a_: