Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
Protein Transketolase (TK), C-domain [52924] (4 species) two N-terminal domains are PP and Pyr modules of thiamin-binding fold |
Species Escherichia coli [TaxId:562] [89712] (4 PDB entries) |
Domain d1qgda3: 1qgd A:528-663 [88369] Other proteins in same PDB: d1qgda1, d1qgda2, d1qgdb1, d1qgdb2 complexed with ca, so4, tpp |
PDB Entry: 1qgd (more details), 1.9 Å
SCOPe Domain Sequences for d1qgda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgda3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]} rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee fgftvdnvvakakell
Timeline for d1qgda3: