Lineage for d1qgda2 (1qgd A:2-332)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393047Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 393048Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 393269Family c.36.1.10: TK-like PP module [88760] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 393276Protein Transketolase (TK), PP module [88761] (3 species)
  7. 393292Species Escherichia coli [TaxId:562] [89656] (1 PDB entry)
  8. 393293Domain d1qgda2: 1qgd A:2-332 [88368]
    Other proteins in same PDB: d1qgda1, d1qgda3, d1qgdb1, d1qgdb3

Details for d1qgda2

PDB Entry: 1qgd (more details), 1.9 Å

PDB Description: transketolase from escherichia coli

SCOP Domain Sequences for d1qgda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgda2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli}
ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgktagvetttgplgqgia
navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
akesawnekfaayakaypqeaaeftrrmkge

SCOP Domain Coordinates for d1qgda2:

Click to download the PDB-style file with coordinates for d1qgda2.
(The format of our PDB-style files is described here.)

Timeline for d1qgda2: