![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Domain d1qgda1: 1qgd A:333-527 [88367] Other proteins in same PDB: d1qgda2, d1qgda3, d1qgdb2, d1qgdb3 complexed with ca, so4, tpp |
PDB Entry: 1qgd (more details), 1.9 Å
SCOPe Domain Sequences for d1qgda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgda1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg ptalilsrqnlaqqe
Timeline for d1qgda1: