Lineage for d1qgda1 (1qgd A:333-527)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986456Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 986457Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 986600Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 986619Protein Transketolase (TK), Pyr module [88736] (4 species)
  7. 986635Species Escherichia coli [TaxId:562] [89650] (4 PDB entries)
  8. 986642Domain d1qgda1: 1qgd A:333-527 [88367]
    Other proteins in same PDB: d1qgda2, d1qgda3, d1qgdb2, d1qgdb3
    complexed with ca, so4, tpp

Details for d1qgda1

PDB Entry: 1qgd (more details), 1.9 Å

PDB Description: transketolase from escherichia coli
PDB Compounds: (A:) protein (transketolase)

SCOPe Domain Sequences for d1qgda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgda1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe

SCOPe Domain Coordinates for d1qgda1:

Click to download the PDB-style file with coordinates for d1qgda1.
(The format of our PDB-style files is described here.)

Timeline for d1qgda1: