Lineage for d1qcbh_ (1qcb H:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 373967Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 374070Protein Heat-labile toxin [50205] (2 species)
  7. 374192Species Escherichia coli, type IIB [TaxId:562] [50207] (3 PDB entries)
  8. 374207Domain d1qcbh_: 1qcb H: [88366]

Details for d1qcbh_

PDB Entry: 1qcb (more details), 2.2 Å

PDB Description: escherichia coli heat labile enterotoxin type iib b-pentamer

SCOP Domain Sequences for d1qcbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcbh_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IIB}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaieleae

SCOP Domain Coordinates for d1qcbh_:

Click to download the PDB-style file with coordinates for d1qcbh_.
(The format of our PDB-style files is described here.)

Timeline for d1qcbh_: