Lineage for d1qcbh_ (1qcb H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788379Protein Heat-labile toxin [50205] (2 species)
  7. 2788531Species Escherichia coli, type IIB [TaxId:562] [50207] (4 PDB entries)
  8. 2788548Domain d1qcbh_: 1qcb H: [88366]

Details for d1qcbh_

PDB Entry: 1qcb (more details), 2.2 Å

PDB Description: escherichia coli heat labile enterotoxin type iib b-pentamer
PDB Compounds: (H:) protein (heat labile enterotoxin type iib b-pentamer)

SCOPe Domain Sequences for d1qcbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcbh_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IIB [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaieleae

SCOPe Domain Coordinates for d1qcbh_:

Click to download the PDB-style file with coordinates for d1qcbh_.
(The format of our PDB-style files is described here.)

Timeline for d1qcbh_: