Lineage for d1q2wb1 (1q2w B:1-301)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2057913Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 2057935Species SARS coronavirus [TaxId:227859] [89349] (71 PDB entries)
  8. 2057957Domain d1q2wb1: 1q2w B:1-301 [88356]
    Other proteins in same PDB: d1q2wb2
    complexed with mpd

Details for d1q2wb1

PDB Entry: 1q2w (more details), 1.86 Å

PDB Description: x-ray crystal structure of the sars coronavirus main protease
PDB Compounds: (B:) nonstructural polyprotein pp1a

SCOPe Domain Sequences for d1q2wb1:

Sequence, based on SEQRES records: (download)

>d1q2wb1 b.47.1.4 (B:1-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
s

Sequence, based on observed residues (ATOM records): (download)

>d1q2wb1 b.47.1.4 (B:1-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictpnyedllirksnhsf
lvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngspsgvy
qcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfygpfv
drqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepltqdh
vdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs

SCOPe Domain Coordinates for d1q2wb1:

Click to download the PDB-style file with coordinates for d1q2wb1.
(The format of our PDB-style files is described here.)

Timeline for d1q2wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q2wb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1q2wa_