SCOP 1.65: Domain d1q0ob2: 1q0o B:148-359

Lineage for d1q0ob2 (1q0o B:148-359)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)

7. Species Brevibacterium fuscum [TaxId:47914] [89888] (3 PDB entries)

8. Domain d1q0ob2: 1q0o B:148-359 [88354]
   full length protein
   complexed with of3

Details for d1q0ob2

PDB Entry: 1q0o, 2.3 Å

PDB Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum (full length protein)

SCOP Domain Sequences for d1q0ob2:

Sequence; same for both SEQRES and ATOM records:

>d1q0ob2 d.32.1.3 (B:148-359) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqaskgf

Timeline for d1q0ob2:

• d1q0ob2 is new in SCOP 1.65
  
• d1q0ob2 appears in SCOP 1.67
  
• d1q0ob2 appears in the current release, SCOPe 2.08