Lineage for d1q0cd2 (1q0c D:148-322)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410374Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 410375Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 410456Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 410512Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 410526Species Brevibacterium fuscum [TaxId:47914] [89888] (3 PDB entries)
  8. 410542Domain d1q0cd2: 1q0c D:148-322 [88350]
    complexed with dhy, fe

Details for d1q0cd2

PDB Entry: 1q0c (more details), 2.1 Å

PDB Description: anerobic substrate complex of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum. (complex with 3,4-dihydroxyphenylacetate)

SCOP Domain Sequences for d1q0cd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0cd2 d.32.1.3 (D:148-322) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeii

SCOP Domain Coordinates for d1q0cd2:

Click to download the PDB-style file with coordinates for d1q0cd2.
(The format of our PDB-style files is described here.)

Timeline for d1q0cd2: