Lineage for d1q0ca1 (1q0c A:4-147)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601425Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 601426Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families) (S)
  5. 601513Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 601596Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 601610Species Brevibacterium fuscum [TaxId:47914] [89888] (3 PDB entries)
  8. 601619Domain d1q0ca1: 1q0c A:4-147 [88343]

Details for d1q0ca1

PDB Entry: 1q0c (more details), 2.1 Å

PDB Description: anerobic substrate complex of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum. (complex with 3,4-dihydroxyphenylacetate)

SCOP Domain Sequences for d1q0ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0ca1 d.32.1.3 (A:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum}
eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
fpyefffetthverlhmrydlysa

SCOP Domain Coordinates for d1q0ca1:

Click to download the PDB-style file with coordinates for d1q0ca1.
(The format of our PDB-style files is described here.)

Timeline for d1q0ca1: