Lineage for d1px6b1 (1px6 B:77-209)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281527Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 281528Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 281529Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 281725Protein Class pi GST [81347] (3 species)
  7. 281726Species Human (Homo sapiens) [TaxId:9606] [47619] (35 PDB entries)
  8. 281773Domain d1px6b1: 1px6 B:77-209 [88335]
    Other proteins in same PDB: d1px6a2, d1px6b2
    complexed with gsh, mes; mutant

Details for d1px6b1

PDB Entry: 1px6 (more details), 2.1 Å

PDB Description: a folding mutant of human class pi glutathione transferase, created by mutating aspartate 153 of the wild-type protein to asparagine

SCOP Domain Sequences for d1px6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px6b1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfanynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d1px6b1:

Click to download the PDB-style file with coordinates for d1px6b1.
(The format of our PDB-style files is described here.)

Timeline for d1px6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1px6b2