Lineage for d1pvof1 (1pvo F:1-47)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286517Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 286542Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 286543Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 286544Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 286545Species Escherichia coli [TaxId:562] [50295] (6 PDB entries)
  8. 286556Domain d1pvof1: 1pvo F:1-47 [88330]
    Other proteins in same PDB: d1pvoa2, d1pvoa3, d1pvob1, d1pvob2, d1pvoc2, d1pvoc3, d1pvod2, d1pvod3, d1pvoe2, d1pvoe3, d1pvof2, d1pvof3
    complexed with anp

Details for d1pvof1

PDB Entry: 1pvo (more details), 3 Å

PDB Description: x-ray crystal structure of rho transcription termination factor in complex with ssrna substrate and anppnp

SCOP Domain Sequences for d1pvof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvof1 a.140.3.1 (F:1-47) Rho termination factor, N-terminal domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d1pvof1:

Click to download the PDB-style file with coordinates for d1pvof1.
(The format of our PDB-style files is described here.)

Timeline for d1pvof1: