Lineage for d1pvoe3 (1pvo E:129-417)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696819Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (16 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 697173Protein Transcription termination factor Rho, ATPase domain [89676] (1 species)
  7. 697174Species Escherichia coli [TaxId:562] [89677] (5 PDB entries)
  8. 697185Domain d1pvoe3: 1pvo E:129-417 [88329]
    Other proteins in same PDB: d1pvoa1, d1pvoa2, d1pvob1, d1pvoc1, d1pvoc2, d1pvod1, d1pvod2, d1pvoe1, d1pvoe2, d1pvof1, d1pvof2

Details for d1pvoe3

PDB Entry: 1pvo (more details), 3 Å

PDB Description: x-ray crystal structure of rho transcription termination factor in complex with ssrna substrate and anppnp
PDB Compounds: (E:) transcription termination factor rho

SCOP Domain Sequences for d1pvoe3:

Sequence, based on SEQRES records: (download)

>d1pvoe3 c.37.1.11 (E:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
nkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmll
qniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvie
kakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnve
eggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrke
ellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk

Sequence, based on observed residues (ATOM records): (download)

>d1pvoe3 c.37.1.11 (E:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
nkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqnia
qsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakr
lvehkkdviilldsitrlarayntvvpaltggvdanalhrpkrffgaarnveeggsltii
atalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqee
lqkmwilrkiihpmgeidameflinklamtktnddffemmk

SCOP Domain Coordinates for d1pvoe3:

Click to download the PDB-style file with coordinates for d1pvoe3.
(The format of our PDB-style files is described here.)

Timeline for d1pvoe3: