Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein Rho termination factor, RNA-binding domain [68910] (1 species) |
Species Escherichia coli [TaxId:562] [68911] (9 PDB entries) Uniprot P03002 |
Domain d1pvoe2: 1pvo E:48-126 [88328] Other proteins in same PDB: d1pvoa1, d1pvoa3, d1pvob2, d1pvoc1, d1pvoc3, d1pvod1, d1pvod3, d1pvoe1, d1pvoe3, d1pvof1, d1pvof3 protein/RNA complex; complexed with anp |
PDB Entry: 1pvo (more details), 3 Å
SCOPe Domain Sequences for d1pvoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvoe2 b.40.4.5 (E:48-126) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg eryfallkvnevnfdkpen
Timeline for d1pvoe2: