Lineage for d1pvoc3 (1pvo C:129-417)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 582685Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (15 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 582999Protein Transcription termination factor Rho, ATPase domain [89676] (1 species)
  7. 583000Species Escherichia coli [TaxId:562] [89677] (4 PDB entries)
  8. 583009Domain d1pvoc3: 1pvo C:129-417 [88323]
    Other proteins in same PDB: d1pvoa1, d1pvoa2, d1pvob1, d1pvoc1, d1pvoc2, d1pvod1, d1pvod2, d1pvoe1, d1pvoe2, d1pvof1, d1pvof2

Details for d1pvoc3

PDB Entry: 1pvo (more details), 3 Å

PDB Description: x-ray crystal structure of rho transcription termination factor in complex with ssrna substrate and anppnp

SCOP Domain Sequences for d1pvoc3:

Sequence, based on SEQRES records: (download)

>d1pvoc3 c.37.1.11 (C:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli}
nkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmll
qniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvie
kakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnve
eggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrke
ellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk

Sequence, based on observed residues (ATOM records): (download)

>d1pvoc3 c.37.1.11 (C:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli}
nkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqnia
qsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakr
lvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnveeggslti
iatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqe
elqkmwilrkiihpmgeidameflinklamtktnddffemmk

SCOP Domain Coordinates for d1pvoc3:

Click to download the PDB-style file with coordinates for d1pvoc3.
(The format of our PDB-style files is described here.)

Timeline for d1pvoc3: